General Information

  • ID:  hor000658
  • Uniprot ID:  Q8WQ55
  • Protein name:  Allatostatin-2
  • Gene name:  ast
  • Organism:  Gryllus bimaculatus (Two-spotted cricket)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gryllus (genus), Gryllinae (subfamily), Gryllidae (family), Grylloidea (superfamily), Gryllidea (infraorder), Ensifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  AGGRQYGFGL
  • Length:  10(69-78)
  • Propeptide:  PASDAAAAQEAAGELLERLENEAGSGATPDDELEFYKRLYDFGVGKRAYSYVSEYKRLPVYNFGLGKRAGGRQYGFGLGKRAGGRQYGFGLGKRTPGDEDDYYFPDEEEEDVPEDNLDDSDSVDKRDRLYSFGLGKRSRPFGFGLGKRAGMYSFGLGKRAQHQYSFGLGKRGEGRMYSFGLGKRPNYERMAGSRFNFGLGKRADANPAYLLSDLGEEKRGPDHRFAFGLGKREVSPNELEAVREEQLHHDKEAQQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibition of juvenile hormone synthesis
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  10(-8) to 7* 10(-8) M
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8WQ55-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000658_AF2.pdbhor000658_ESM.pdb

Physical Information

Mass: 118585 Formula: C46H68N14O13
Absent amino acids: CDEHIKMNPSTVW Common amino acids: G
pI: 9.35 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: -25 Boman Index: -713
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 49
Instability Index: 2457 Extinction Coefficient cystines: 1490
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  7673141
  • Title:  A Family of Neuropeptides That Inhibit Juvenile Hormone Biosynthesis in the Cricket, Gryllus Bimaculatus